Leverage AI to accelerate drug discovery pipelines from target identification to lead optimization.
## Drug Discovery Pipeline
``` Traditional Timeline: 10-15 years, $2.6B average cost
AI-Accelerated Pipeline: ┌─────────────┐ ┌─────────────┐ ┌─────────────┐ │ Target │ │ Hit │ │ Lead │ │ ID │──▶│ Discovery │──▶│ Optim. │ │ (AI: 6mo) │ │ (AI: 3mo) │ │ (AI: 6mo) │ └─────────────┘ └─────────────┘ └─────────────┘ │ │ │ ▼ ▼ ▼ AlphaFold Virtual HTS ADMET Prediction Literature AI Generative Chem Molecular Dynamics ```
## Key AI Applications
### Protein Structure Prediction ```python # Using ESMFold for protein structure from transformers import EsmForProteinFolding
model = EsmForProteinFolding.from_pretrained("facebook/esmfold_v1")
# Predict 3D structure from amino acid sequence sequence = "MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH" structure = model.infer_pdb(sequence)
# Output: PDB file with predicted 3D coordinates ```
### Virtual Screening with AI ```python # Screen millions of compounds virtually from deepchem.models import GraphConvModel
# Train model on known active/inactive compounds model = GraphConvModel(n_tasks=1, mode='classification') model.fit(training_dataset, nb_epoch=50)
# Screen compound library predictions = model.predict(compound_library) top_candidates = rank_by_predicted_activity(predictions) ```
### Generative Chemistry ``` AI-Generated Molecules: Input: "Generate molecules similar to aspirin with improved solubility" Output: Novel molecular structures optimized for: - Binding affinity to target - Drug-likeness (Lipinski rules) - Synthetic accessibility - ADMET properties ```
## Real-World Success Stories - Insilico Medicine: AI-designed drug entered Phase 2 trials in 18 months - Recursion: AI platform screening 1.5M compounds weekly - Isomorphic Labs: DeepMind spinoff using AlphaFold for drug design